PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000936441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 339aa    MW: 38609.8 Da    PI: 7.3896
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000936441genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM140.78.9e-44181451128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                    lppG+rF Ptd+el+ +yL +kv +++l++ + ++ v++y+++P+dL       +e+ewyfF++r++ky++g r+ ra+++gyWkatgk  ++++ 
  MDP0000936441  18 LPPGYRFVPTDDELILHYLMRKVLNEQLPI-NRFRIVNLYDHHPRDLTgDYNLIRESEWYFFTSRRRKYPRGGRPCRAADNGYWKATGKPDDIKDD 112
                    79****************************.7799************9433345889*************************************** PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +g+++g k+tL +y+g++ kg+ktdW mhey+l
  MDP0000936441 113 NGQVIGSKRTLDYYEGKQGKGTKTDWKMHEYKL 145
                    *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5215172IPR003441NAC domain
PROSITE profilePS5100549.82618173IPR003441NAC domain
PfamPF023651.2E-2319145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MVPVLNEVGP VDAYIDSLPP GYRFVPTDDE LILHYLMRKV LNEQLPINRF RIVNLYDHHP  60
RDLTGDYNLI RESEWYFFTS RRRKYPRGGR PCRAADNGYW KATGKPDDIK DDNGQVIGSK  120
RTLDYYEGKQ GKGTKTDWKM HEYKLNKETA PSNQIDGTNM KLDDCVLCKI YKNSRIKKDG  180
KNNDDNAPQS TIRTDQGAIL PAATNTVTSH AFPDQSIQHP YLFTGESSGT TSSIVNKHCV  240
TSTSTTPAYY EQHYFQNQTW SDHPGPIHNX NNQIPPPREP FSSQFPLPNS MEHQIGAGWE  300
SVNGMPVVDS SSIRLLPHVR EYERELKAMR NNEGQGTW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-421717114166Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334972.10.0PREDICTED: NAC domain-containing protein 67-like
TrEMBLM5W9A72e-78M5W9A7_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15078714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.21e-43NAC domain containing protein 47